PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK01183.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 63aa    MW: 7130.81 Da    PI: 8.2199
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK01183.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538e-171862145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw+
        PK01183.1 18 KGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL 62
                     79******************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-191161IPR009057Homeodomain-like
SuperFamilySSF466897.25E-141362IPR009057Homeodomain-like
PROSITE profilePS5129418.1481363IPR017930Myb domain
SMARTSM007178.0E-51763IPR001005SANT/Myb domain
PfamPF002491.8E-151862IPR001005SANT/Myb domain
CDDcd001675.16E-92061No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
DYTRTCSGNS SEEVEVRKGP WTMEEDLILI NYIANHGEGV WNSLAKAAGL KRTGKSCRLR  60
WLX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879077.18e-31PREDICTED: myb-related protein 305-like
SwissprotQ9LK958e-30MYB21_ARATH; Transcription factor MYB21
TrEMBLA0A0L9VPL33e-30A0A0L9VPL3_PHAAN; Uncharacterized protein
TrEMBLA0A0R0EIJ22e-30A0A0R0EIJ2_SOYBN; Uncharacterized protein (Fragment)
TrEMBLM5XIW32e-30M5XIW3_PRUPE; Uncharacterized protein
TrEMBLQ70RD22e-30Q70RD2_GERHY; MYB8 protein
STRINGSolyc02g086690.2.11e-29(Solanum lycopersicum)
STRINGPGSC0003DMT4000012783e-29(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.15e-31myb domain protein 21